Pop drop · Free shipping over $55 · Squiggle sale

Recombinant Gossypium hirsutum NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic(ndhA) RNA Digestion Dugaiczyk A

SKU 49305235298
4.6
USD1202.60 USD1224.60

Pay in 4 interest-free payments of $300.65 Learn more

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Sep 24 - Sep 29

Description

Dugaiczyk A

Expression Region:1-554

Gene Names: isdB

AA Sequence:MELLTQLLQALWAQDFETLANPSMIGMLYFVLFVILFLENGLLPAAFLPGDSLLVLVGVL IAKGAMGYPQTILLLTVAASLGCWVSYIQGRWLGNTRTVQNWLSHLPAHYHQRAHHLFHK HGLSALLIGRFIAFVRTLLPTIAGLSGLNNARFQFFNWMSGLLWVLILTTLGYMLGKTPV FLKYEDQLMSCLMLLPVVLLVFGLAGSLVVLWKKKYGNRG

Recombinant Gossypium hirsutum NAD(P)H-quinone oxidoreductase subunit 1, chloroplastic(ndhA) RNA Digestion Dugaiczyk ASize: 50 ug. Other sizes are also available. Product Type: Recombinant Protein Species: Gossypium hirsutum (Upland cotton) (Gossypium mexicanum) Uniprot NO.: Q2L952 Tag Info: The tag type will be determined during production process. Storage Buffer: Tris based buffer,50% glycerol, optimized for this protein Storage: Store at 20, for extended storage, conserve at 20 or 80. Notes: Repeated freezing and thawing is not recommended. Store working aliquots

Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy

You may also like

recommand products